Contacter l'auteur / Contact the author

Recherche dans ce site / Search in this site

 

 

 

 

 

Microbiologie du Covid-19

Une opératrice prépare les échantillons des tests RT-PCR pour le Covid-19 dans un laboratoire de Berlin, le 26 mars 2020. Document Axel Schmidt/Reuters.

Les différents variants (III)

Pour rappel, les mots "variant" et "souche" sont synonymes. Seule différence, le mot "variant" est plus moderne car il insiste sur les mutations, les variations génétiques du virus.

Insistons sur le fait que l'apparition de variants n'étonne pas les chercheurs. Comme nous l'avons expliqué, le Covid-19 évolue et mute constamment, comme le font tous les virus. De tels changements sont donc prévisibles. Un problème se pose lorsqu'un variant présente une mutation qui facilite sa propagation ou lui permet d'échapper aux défenses du système immunitaire. On y reviendra.

Premières mutations

La première mutation du Covid-19 fut observée le 8 janvier 2020 chez un patient de Wuhan (génome WH-09). Il s'agit de la substitution de la base nucléique C par une base nucléique U sur la 186e position de son ARN. En dehors de Wuhan, la même mutation fut trouvée le 27 février 2020 sur un autre patient à 1000 km de là, à Guangzhou (Canton). Cet échantillon (génome GZMU0030) pourrait être un descendant direct de celui de Wuhan ou il peut s'agir d'un autre variant partageant un ancêtre commun. 

Au cours des semaines suivantes, le variant de Guangzhou subit deux autres mutations non silencieuses : la première sur la protéine non structurale ORF1a où un acide aminé muta en isoleucine (I), la seconde sur la protéine E où une acide aminé fut également modifié.

Arrêtons-nous un instant pour souligner que ces changements génétiques concernent la mutation d'une seule base nucléique sur ORF1 par exemple qui comprend environ 20000 bases. Son effet sur la fonction du gène qu'elle affecte (cf. les biostatistiques page précédente) est aussi insignifiant que remplacer la couleur d'une seule pièce d'un puzzle

Comme expliqué précédemment, le virus peut ainsi subir des centaines de substitutions de ses acides aminés sans pour autant altérer la manière dont ses protéines clés s'attachent aux cellules qu'il infecte. C'est sur ce principe que sont développés les vaccins qui restent efficaces malgré les nombreuses mutations du virus qui surviennent entre leur développement et leur mise sur le marché. Mais à l'impossible, nul n'est tenu. Il arrive un jour où le nombre de mutations est tel que le vaccin n'est plus adapté au virus et perd son efficacité. Il est alors grand temps de développer un nouveau vaccin adapté au nouveau variant, ce qui peut parfois se réaliser en moins d'un mois.

Ensuite, lorsque le virus se propagea dans toute la Chine puis sur les autres continents, des variants spécifiques se développèrent dans certaines régions ou villes (Shanghaï, Beijing, Lombardie, Haute-Savoie, New York, Washington, Californie, Victoria en Australie, etc). Parmi ces variants, le génome BavPat1 découvert à Munich provenait de Wuhan via Shanghaï, un génome quasi identique au BJ2460 de Beijing fut découvert en Belgique, le génome WA1 de Seattle et UC4 de Californie provenaient de personnes ayant visité Wuhan. D'autres variants comme ceux de New York avaient transité par l'Iran (génome NY1-PV08001) ou par l'Europe.

Enfin, les variants européens et américains sont devenus de nouveaux foyers infectieux qui exportèrent le virus en Amérique du Sud et le réinduisirent en Asie.

Schéma du génome ARN simple brin du Covid-19. Son ARN contient environ 30000 bases ou nucléotides codant 4 protéines de structure (en rouge, S, E, M et N), 9 facteurs ou protéines accessoires (en vert) et 2 polyprotéines (en jaune, ORF1a et ORF1b) contenant 16 protéines (en bleu) non structurales (NSP). Document The New York Times adapté par l'auteur.

Au fil des mois, certaines parties du génome du Covid-19 subirent de nombreuses mutations. Certaines protéines furent peu modifiées et d'autres pas du tout. Entre décembre 2019 et avril 2020, quelque 4400 acides aminés du génome du Covid-19 furent substitués, certains emplacements du génome qu'on appelle des "hot spots" étant plus tolérants aux mutations, d'autres ne tolérant aucune mutation et étant critique pour le virus. 185 mutations sont apparues de façon récurrente.

Au total, en 2020 les virologues ont recensé plus de 12000 mutations du Covid-19. Si c'est impressionnant, en les analysant on constate que la majorité d'entre elles n'a pas amélioré sa transmissibilité (cf. L.von dorps et al., 2020). En revanche, les nouveaux variants découverts en fin d'année sont plus transmissibles (voir plus bas).

Nous avons constaté que le Covid-19 fut particulièrement meurtrier en Italie, au Brésil et à New-York. En Italie, il y eut 919 décès le 27 mars 2020, 615 décès au Brésil le 6 mai 2020 et 574 décès rien qu'à New York le 4 avril 2020 (et 2624 décès aux Etats-Unis le 21 avril 2020). Si la raison de cette hécatombe très localisée n'est pas encore établie, quelques pistes ont été explorées. Même si elles ne sont pas encore convaincantes, elles suggèrent qu'il existerait des variants très virulents (sans écarter les facteurs de risque ainsi que les prédispositions génétiques et/ou immunitaires).

Dans une étude publiée dans la revue "National Science Review" le 3 mars 2020, Jian Lu et ses collègues ont analysé 103 génomes complets prélevés sur des patients chinois, australiens et coréens et sont arrivés à la conclusion qu'il existerait deux variants ou souches distinctes du Covid-19 : "la souche L et la souche S". La souche L aurait muté à partir de la souche S et serait plus agressive puisqu'elle serait responsable de 70% des contaminations contre 30% pour la souche S.

Une autre étude réalisée sur 11 patients comprenant 8 hommes et 3 femmes publiée en avril 2020 suggère également l'existence de plusieurs variants dont certains présentent une charge virale 270 fois plus importante que d'autres. Certains variants ont subi 33 mutations dont 19 sont nouvelles.

Phylogénie du Covid-19 établi à partir de 94 patients traités en Chine. Les cas ayant des antécédents de contact dans le marché de Wuhan sont indiqués. Document H.Lu et al. (2020).

Sur base des analyses faites par GISAID, les chercheurs concluent que les variants du Covid-19 circulant en Europe et à New York seraient les plus virulents tandis que ceux circulant ailleurs dans les États-Unis seraient les plus modérées (cf. M.Zheng et al., 2020).

A ce jour, cette hypothèse n'a pas été confirmée. En revanche, nous verrons que certains variants sont plus transmissibles que d'autres. Mais ce n'est peut-être pas la seule raison qui les rend plus virulents. Enfin, la sensibilité de la personne contaminée (ses gènes, son âge, son genre, ses facteurs de risque, etc.) représente aussi un facteur déterminant.

Comme l'étude précédente de l'équipe de Tang, les conclusions de Zheng et ses collègues furent également critiquées compte tenu du très faible échantillonnage et du séquençage simple (chaque gène n'est lu qu'une fois) introduisant potentiellement un taux élevé d'erreurs.

Néanmoins, cette hypothèse confirme une étude de l'Université Northeastern qui avait déjà montré que le Covid-19 présent à New York provenait d'Europe, probablement via l'Italie, où il fit énormement de victimes.

Dans une autre étude publiée dans la revue "Nature" le 20 mai 2020, Hongzhou Lu de l'Université Fudan de Shanghaï et ses collègues ont analysé les données cliniques, moléculaires et immunologiques de 326 patients Covid hospitalisés à Shanghaï. Comme on le voit sur le cladogramme présenté à gauche, les séquences génomiques virales de 94 patients Covid furent analysées et ont montré une évolution stable des variants.

Dans l'échantillonnage, il y avait deux lignées majeures (Clade I et II) avec un historique d'exposition différentiel pendant la phase précoce de l'épidémie à Wuhan. Néanmoins, ils ont montré une virulence et des résultats cliniques similaires, en particulier dans la progression de la maladie. Selon les chercheurs, "Les déterminants de la gravité de la maladie semblaient provenir principalement de facteurs de l'hôte tels que l'âge et la lymphocytopénie (et sa tempête de cytokines associée), alors que la variation génétique virale n'affectait pas de manière significative les résultats". Ceci est une très bonne nouvelle pour le développement d'un vaccin.

Selon les données du CDC américain, de la base Nextstrain et de l'OMS, voici les caractéristiques des principaux variants du Covid-19.

VOC et VOI

Pour les chercheurs, il existe plusieurs types de variants, les VOC (variants of concern ou variants préoccupants), les VOI (variants of interest ou variant d'intérêt) et les autres variants sous surveillance. Ces acronymes sont parfois utilisés dans les articles scientifiques. Voici les définitions de l'ECDC.

Les VOC : pour ces variants, des preuves claires sont disponibles indiquant un impact significatif sur la transmissibilité, la gravité et/ou l'immunité qui est susceptible d'avoir un impact sur la situation épidémiologique. Les preuves génomiques, épidémiologiques et in vitro combinées de ces propriétés invoquent une confiance au moins modérée. En outre, tous les critères pour les variants d'intérêt et sous surveillance décrits ci-dessous s'appliquent.

Les VOC du SARS-CoV-2 sont : B.1.1.7, B.1.1.7+E484K, B.1.351, P1 et B.1.617.2.

Les VOI :  pour ces variants, des preuves sont disponibles sur les propriétés génomiques, des preuves épidémiologiques ou des preuves in vitro qui pourraient indiquer un effet significatif sur la transmissibilité, la gravité et/ou l'immunité, ayant un impact réaliste sur la situation épidémiologique. Cependant, les preuves sont encore préliminaires ou associées à une incertitude majeure. En outre, tous les critères pour les variants sous surveillance décrits ci-dessous s'appliquent.

Les VOI du SARS-CoV-2 sont : B.1.525, B.1.427/B.1.429, P.3, B.1.616, B.1.617.1, B.1.617.3, B.1.620 et B.1.621.

Les autres variants sous surveillance. Ces variants supplémentaires du SARS-CoV-2 ont été détectés grâce à des systèmes d'intelligence artificielle épidémique, au dépistage de variants génomiques basé sur des règles ou sur des preuves scientifiques préliminaires. Il y a des indications qu'ils pourraient présenter des propriétés similaires à celles d'un VOC, mais les preuves sont faibles ou n'ont pas encore été évaluées par l'ECDC (ou le CDC). Les variants énumérés ci-dessous doivent être présents dans au moins une épidémie, détectés dans une communauté en Europe, ou il doit y avoir des preuves qu'il existe une transmission communautaire du variant ailleurs dans le monde.

Ces autres variants sont : B.1.214.2, A.23.1+E484K, A.27, A.28, C.16, C.37, B.1.351+P384L, B.1.351+E516Q, B.1.1.7+L452R, B.1.1.7+S494P, C.36+L452R, AT.1, B.1.526, B.1.526.1, B.1.526.2, B.1.1.318, P.2, B.1.1.519 et AV.1.

En résumé, lorsqu'un virus surveillé est reclassé de VOI à VOC, il présente davantage de risques pour le public. Comme le rappelle l'OMS, "Plus le SARS-CoV-2 circule, plus il a de possibilités de muter" et plus il faut enrayer rapidement sa propagation.

Nouvelle nomenclature de l'OMS

Le 31 mai 2021, l'OMS proposa un nouveau système de codage pour nommer les variants du SARS-CoV-2. Jusqu'alors un variant pouvait s'appeller par exemple B.1.1.7 ou 20I/501Y.V1 ou encore VOC 202012/01. Certains pays hésitaient à déclarer un nouveau variant car dans certains cas il prend le nom du pays. Pour ne pas stigmatiser certaines pays et afin de rendre la nomenclature neutre, l'OMS décida d'utiliser les lettres de l'alphabet grec : Alpha, Beta, Gamma, etc. Ainsi le B.1.1.7 a été renommé Alpha.  Cette nouvelle nomenclature a été appliquée aux bases de données GISAID, Nextstrain et Pango. Nous verrons ce que décidera l'OMS quand elle aura atteint la 24e et derrière lettre de l'alphabet, Omega.

Le variant D614G (EU)

Dans un article publié dans la revue "Cell" le 2 juillet 2020 par la biologiste Bette Korber du Laboratoire National de Los Alamos (LANL) et ses collègues, les chercheurs ont constaté que le Covid-19 est devenu plus contagieux avec le temps. Le variant dominant depuis mars 2020 nommée D614G (ou G614) provient d'Europe et s'est ensuite installé aux Etats-Unis.

Document Cell publié sur Twitter et adapté par l'auteur.

Dans une étude publiée un mois plus tôt sur "bioXrev" (non validée), les chercheurs avaient montré que ce variant ne diffère de son ancêtre que par une seule lettre de l'ARN caractérisant la protéine S. Dans ce premier article, Korber qui est spécialisée en biologie moléculaire et génétique des populations virales avait affirmé à propos de D614G que "lorsqu'il est introduit dans de nouvelles régions, il devient rapidement la forme dominante".

Cette conclusion fut critiquée par leurs confrères car les chercheurs n'avaient pas prouvé que la mutation elle-même avait provoqué sa domination. En effet, c'est peut-être le résultat d'autres facteurs ou l'effet du hasard.

Les chercheurs ont donc réalisé des analyses et des expériences complémentaires, notamment à la demande des éditeurs de la revue "Cell". Il ressort de cette étude que sur les 999 patients examinés, ceux porteurs de cette mutation virale produisaient plus de virions mais sans que cela ne change la gravité de leur maladie, ce qui est rassurant. Quant aux expériences en laboratoire, elles ont montré que la nouvelle mutation pouvait contaminer 3 à 6 fois plus plus de cellules humaines.

Korber affirma que "Le variant du SARS-CoV-2 qui domine aujourd’hui dans le monde infecte plus facilement les cellules que celui qui est apparu à l'origine en Chine, ce qui le rend probablement plus contagieux entre humains bien que cela reste à confirmer".

Interrogé le 2 juillet 2020 par un chroniqueur du journal "JAMA" (cf. la vidéo sur YouTube), l'immunologue Anthony Fauci, directeur de l'Institut des maladies infectieuses américain (NIAID) et responsable de la Task Force Covid-19 auprès de la Maison Blanche déclara : "Nous ne savons pas encore si une personne s'en sort moins bien ou non [avec le nouveau variant D614G]. Il semble que le virus se réplique mieux et puisse être plus transmissible, mais nous en sommes toujours au stade d’essayer de le confirmer. Mais il y a de très bons généticiens des virus qui travaillent là-dessus".

En résumé, les chercheurs concluaient en juillet 2020 que si le variant D614G du Covid-19 est sans doute plus infectieux que le virus original de Wuhan, il n'est pas forcément plus transmissible entre humains. Mais deux nouvelles études ont corrigé cette dernière affirmation.

Toutes les protéines des virus (structurales, non structurales et accessoires) sont sujettes à mutations dans des proportions et à des taux qui varient d'un lieu à l'autre. Document T.Lombry.

Dans une étude publiée dans la revue "Nature" le 26 octobre 2020, soit en ayant plus de 8 mois de recul par rapport aux premières études sur le nouveau variant, le microbiologiste Kenneth S. Plante de la Branche Médicale de l'Université du Texas (UTMB) et ses collègues ont examiné la mutation subie par D614G (alias USA-WA1/2020) dans sa protéine S et caractérisé son effet.

Selon les auteurs, le variant "D614G accroît la réplication sur les cellules épithéliales pulmonaires et les tissus des voies respiratoires humaines primaires grâce à une amélioration du pouvoir infectieux des virions". Les chercheurs ont infecté des hamsters par le variant G614 qui a produit des titres infectieux plus élevés dans les échantillons nasaux et de la trachée, mais pas dans les poumons, "confirmant les preuves cliniques que le variant D614G augmente les charges virales dans les voies respiratoires supérieures des patients Covid et peut augmenter la transmission".

Ils ont également constaté que les sérums de hamsters infectés par le variant D614 présentent des titres de neutralisation légèrement plus élevés contre le variant G614 que contre le D614, indiquant que "la mutation ne réduit peut-être pas la capacité des vaccins dans les essais cliniques contre le Covid-19 et que les anticorps thérapeutiques doivent être testés contre le virus G614 en circulation". On y reviendra.

Ils soulignent enfin l'importance du variant D614G dans la propagation de l'épidémie, l'efficacité des vaccins et de la thérapie par anticorps.

Une autre étude publiée dans la revue "Science" le 12 novembre 2020 par Yoshihiro Kawaoka des universités du Wisconsin et de Tokyo et ses collègues confirme que le variant D614G présente une réplication ex vivo et une transmission in vivo plus efficaces (cf. le génie génétique)

Selon les chercheurs, "Le variant D614G présente une infectiosité, une réplication et une aptitude compétitive plus efficaces dans les cellules épithéliales des voies respiratoires humaines primaires, mais conserve une morphologie et des propriétés de neutralisation in vitro similaires, par rapport au virus ancestral sauvage." En d'autres termes, le variant D614G du Covid-19 s'est adapté. Pour une charge virale similaire dans les tissus respiratoires, il infecte beaucoup plus rapidement les cellules. C'est notamment ce variant qui est l'origine de la perte d'odorat (anosmie).

Les infectiologues sont d'avis que cela ne change rien dans les mesures de protection à respecter pour ralentir l'épidémie.

Enfin, dans une étude publiée dans la revue "Science Advances" le 16 avril 2021 sur le variant D614G, des chercheurs confirment que la forme G est plus infectieuse in vitro et est associée à une augmentation des charges virales dans les voies respiratoires supérieures. Des simulations montrent que l'infectiosité accrue de la forme G est probablement due à un taux plus élevé de liaisons réussies avec le récepteur ACE des cellules hôtes. Nous verrons que c'est aussi son point faible.

Les variants 20A.EU1 et 20A.EU2 (EU)

Dans un article publié sur "medRxiv" (non validée) le 28 octobre 2020, Emma B. Hodcroft de l'Université de Bâle en Suisse et ses collègues ont annoncé la découverte d'un nouveau variant du Covid-19 au début de l'été 2020, vraisemblablement en Espagne, qui s'est ensuite propagé à plusieurs pays européens.

En juillet 2020, le variant nommée 20A.EU1 représentait plus de 40% des cas de contamination en Espagne. En dehors de l'Espagne, de fréquences très faibles avant le 15 juillet, elle passa en septembre à 40-70% en Suisse, en Irlande et au Royaume-Uni. Ce variant est également présent en Norvège, en Lettonie, aux Pays-Bas et en France. Elle s'est ensuite propagée en Nouvelle Zélande et à Hong Kong et probablement dans d'autres pays.

Ce variant porte la mutation A222V sur la protéine S. Les tests montrent que les anticorps humains sont légèrement moins efficaces pour neutraliser les variants portant cette mutation.

Un autre variant nommé 20A.EU2 est présent en France et en Slovaquie et émerge en Belgique, aux Pays-Bas, en Allemagne, en Norvège et en Suède. En novembre 2020, les chercheurs ne disposaient pas de suffisamment de données de séquençages pour évaluer leurs fréquences dans d'autres pays.

Il est actuellement difficile de savoir si ces variants se propagent en raison d'un avantage de transmission du virus ou si une incidence élevée en Espagne suivie d'une diffusion par les touristes est suffisante pour expliquer l'augmentation rapide dans plusieurs pays.

A gauche, aperçu phylogénétique du Covid-19 en Europe. L'arbre montre un échantillon représentatif d'isolats d'Europe colorés par l'acide aminé aux positions 222, 477 et 614 de la protéine S. Un nouveau variant à propagation rapide (20A.EU1, en bleu) avec la mutation S:A222V sur un fond S:D614G est apparu au début de l'été 2020 et est présent dans la plupart des pays avec des séquences récentes. Un variant distinct (20A.EU2) avec la mutation S:477N est répandu en France et quelques autres pays. A droite, la proportion de séquences appartenant à chaque variant (sur la durée de la pandémie) dans chaque pays. Document E.B. Hodcroft et al. (2020) basé sur Nextstrain.

Les chercheurs confirment que le variant 20A.EU1 serait apparu chez des travailleurs agricoles espagnols provenant de deux foyers connus situés dans le nord-est du pays. Le virus contamina ensuite des travailleurs en Aragon et en Catalogne avant de se propager dans la région de Valence et dans le reste du pays.

Selon les chercheurs, "Le variant 20A.EU1 diffère des séquences ancestrales d'au moins 6 positions, dont la mutation A222V dans la protéine S et A220V dans la nucléoprotéine [...]. Le variant 20A.EU2 présente une mutation S447N sur la protéine S".

Le variant B.1.1.7 (GB)

L'existence du variant B.1.1.7 du Covid-19, renommé Alpha par l'OMS et également connu sous les codes 20I/501Y.V1, VOC 202012/01 ou VUI-202012/01, fut annoncée par Matt Hancock, le Sécrétaire britannique de la Santé le 14 décembre 2020 et confirmée par Patrick Vallance, le conseiller scientifique du gouvernement britannique au cours d'une conférence de presse qui s'est tenue le 19 décembre 2020.

Le variant B.1.1.7 fut identifié mi-septembre 2020 chez des patients hospitalisés à Londres et dans le Kent. Selon le "Guardian" qui rapporte un communiqué de l'agence de la santé publique britannique (PHE), au 13 décembre 2020 le nouveau variant avait contaminé 1108 personnes. Au 19 décembre 2020 il était à l'origine de 62% des contaminations enregistrées à Londres, de 43% dans le sud-est de l'Angleterre et de 59% dans l'est du pays et dominant à présent les autre variants (cf. ce tweet de Tony Cox). Le variant fut identifié aux États-Unis fin décembre 2020.

Au départ, le variant B.1.1.7 avait surtout contaminé des jeunes de moins de 20 ans, mais au fil des semaines il apparaît qu'il contamine tout le monde sans aucune préférence d'âge. Vu sa propagation plus rapide et le nombre croissant de paients Covid aux soins intensifs depuis février 2021, ce variant est entre 35 et 90% plus contagieux ou transmissible que l'ancienne souche et semble aussi plus virulent car les personnes contaminées, jeunes ou adultes, peuvent présenter du jour au lendemain des symptômes graves exigeant une prise en charge aux soins intensifs.

A consulter : Variant B.1.1.7, ECDC

Localisation et nature des mutations du variant B.1.1.7 du Covid-19. A droite, les délétions des 69e et 70e acides aminés et la substitution N>Y en position 501 du gène codant la protéine S du variant B.1.1.7. Documents Andrew Rambaut et al. (2020)/Covid-19 Genomics Consortium U.K et NYTimes adaptés par l'auteur.

Ce variant comprend 22 mutations par rapport à la lignée ancestrale B.1.1 et 5 délétions, la majorité se trouvant dans la région génomique encodant la protéine S au niveau du domaine de liaison au récepteur (RBD). Plusieurs mutations sont importantes :

- La substitution en N501Y3 (N→Y en position 501) est une mutation qui augmente les capacités d'attachement du virus au récepteur ACE2 des cellules humaines et par conséquent elle facilite la propagation du virus. Cette mutation n'aura probablement pas d'effet sur les vaccins actuels. On y reviendra.

- Une double délétion aux positions H69-V70. Elle est identique à la mutation qui infecta les visons en novembre 2020 au Danemark. Comme le confirme une étude publiée sur "bioRxiv" le 14 janvier 2021, cette délétion permet au virus de se transmettre plus facilement et donc de plus facilement contaminer les cellules. Comme la délétion Y144-145, elle modifie la forme de la protéine S et peut aider le virus à échapper à certains anticorps monoclonaux et polyclonaux.

- La mutation P681H permet aux cellules infectées de fabriquer plus efficacement de nouvelles protéines S.

- La mutation A222V sur la protéine S rend les anticorps légèrement moins efficaces. C'est une mutation d'échappement.

- La mutation E484K est une substitution E→K (acide glutamique en lysine) ou E→Q (glutamine) ou E→P (proline). Sa présence sur le B.1.1.7 fut annoncée officiellement le 1 février 2021 par le PHE.

E484K est une mutation d'échappement qui modifie suffisamment la forme du domaine de liaison au récepteur (RBD) pour permettre au virus d'échapper à certains types d'anticorps monoclonaux et polyclonaux. Les tests montrent qu'elle diminue de 35 à 60 fois la capacité de neutralisation des anticorps anti-RBD chez le sujet contaminé.

Cette mutation est identique à celle du variant découvert au Brésil (voir plus bas). Cette mutation explique en partie la propagation plus rapide de ce variant dans la population que les souches antérieures.

Dans la plupart des cas, c'est la présence d'un variant porteur de la mutation d'échappement E4848K qui explique les cas de recontamination. On y reviendra.

D'où provient le variant B.1.1.7 ? On l'ignore encore. À ce jour, aucun virus étroitement apparenté n'étaye la théorie selon laquelle le variant proviendrait de l'étranger. Sur base des données de décembre, les schémas de mutations observées suggèrent qu'il s'agit d'une évolution adaptative au Royaume-Uni.

Des schémas de mutations similaires ont été observés dans l'évolution du Covid-19 chez des patients infectés chroniquement ayant un système immunitaire affaibli. L'hypothèse actuelle est qu'un tel scénario d'infection chronique chez un seul patient peut avoir joué un rôle dans l'émergence de ce variant.

MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHA H VSGTNGTKRFDNP

VLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGV Y YHKNNKSWMESEFRVYSSAN

NCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLT

PGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNI

TNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPG

QTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSY

GFQPT Y GVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDI D DTTDA

VRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQGVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNN

SYECDIPIGAGICASYQTQTNS H RRARSVASQSIIAYTMSLGAENSVAYSNNSIAIP I NFTISVTTEILPVSMTKTSVDCTMYIC

GDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLA

DAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQ

NVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDIL A RLDKVEAEVQIDRL

ITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTA

PAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITT H NTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSP

DVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCS

CGSCCKFDEDDSEPVLKGVKLHYT

A gauche, emplacement des mutations N501Y sur la protéine S du variant B.1.1.7 du Covid-19. A droite, les substitutions et délétions (ablations) des acides aminés dans le génome codant la protéine S du B.1.1.7. Ces mutations peuvent altérer la forme de la protéine et en grands nombres elles peuvent modifier sa fonction et forcer les pharmacologues à modifier le vaccin.

Soulignons que les délétions particulières identifiées dans la protéine S du variant B.1.1.7 sont apparues dans plusieurs autres lignées du virus à une fréquence croissante et sont également observées chez les patients victimes d'infections chroniques où elles peuvent altérer l'antigénicité, c'est-à-dire la reconnaissance par les anticorps immunitaires. Ces délétions peuvent également être associées à d'autres mutations dans la région de liaison de la protéine S du virus, notamment celles observées dans les infections chez les visons d’élevage et à une mutation qui joue un rôle dans la capacité du virus à échapper au système immunitaire humain. B.1.1.7 contient également un gène ORF8 tronqué, avec des délétions dans cette région précédemment associées à une diminution de la gravité de la maladie.

Au 1 janvier 2021, le variant B.1.1.7 était déjà en Europe continentale et s'était propagé dans plus de 30 pays, de la France à la Chine, en passant par l'Islande, les États-Unis et l'Australie notamment. Le 8 janvier 2021, il avait touché 45 pays et continuait à se propager. Le variant dominait en Belgique fin février 2021, une tendance similaire à ce qui fut observé au Royaume-Uni. On observe la même infectiosité accrue pour les variants B.1.351 et P.1 du fait qu'ils portent plusieurs mutations identiques à celle du B.1.1.7.

C'est ce variant qui est à l'origine du maintien du taux élevé de contaminations qu'on a observé en Europe depuis début 2021 (cf. les deuxième et troisième vagues épidémiques).

Le variant B.1.177 (GB)

Le variant B.1.177 est apparu le 14 février 2020 au Royaume-Uni (73%) et s'est ensuite propagé au reste du monde bien qu'il soit surtout représenté en Europe occidentale et en particulier au Royaume-Uni. Il compte actuellement au moins 85 sous-variants généralement associés à une région ou un pays.

Le variant B.1.36.17 (GB)

Le variant B.1.36.17 est apparu le 16 juillet 2020 au Royaume-Uni (98%) et tend à se propager en Suisse (1%) et ailleurs en Europe ainsi qu'aux Etats-Unis (< 1%).

Le variant B.1.36.28 (GB)

Le variant B.1.36.28 est apparu le 9 septembre 2020 du Royaume-Uni et reste actuellement isolé à la Grande Bretagne (99%) et Gibraltar (1%).

Le variant B.1.221 (NL)

Le variant B.1.221 est apparu le 14 février 2020 aux Pays-Bas et s'est rapidement répandu en Europe. Quatre sous-variants propres à l'Allemagne, le Danemark et la Belgique/Luxembourg ont déjà été identifiés. On le signale également en Corée et aux Etats-Unis.

Le variant B.1.351 (ZA)

Le variant B.1.351 ou Beta, également appelé 501.V2 fut découvert à Nelson Mandela Bay, en Afrique du Sud, en octobre 2020. Il est identique au variant britannique B.1.1.7. Cependant, les deux mutations sont apparues séparément.

En février 2021, le variant B1.351 s'était déjà propagé dans 32 pays, dont l'est de l'Afrique, la Zambie, le Ghana, aux États-Unis, au Canada, en Europe, en Turquie, en Israël et en Chine. Il tua une personne en Belgique alors qu'elle n'avait pas voyagé.

Trois mutations se situent près de la protéine S :

- N501Y aide le virus à s'accrocher plus étroitement aux cellules humaines. Cette mutation apparaît également dans les variants B.1.1.7 et P.1 (cf. P.Dormitzer et al., 2020).

- K417N aide également le virus à se lier plus étroitement aux cellules humaines.

- E484K peut aider le virus à échapper à certains types d'anticorps monoclonaux et polyclonaux.

Le variant P.1 (BR)

Le variant P.1 ou Gamma, également appelé B.1.1.28.1 (ou encore 20J/501Y.V3) fut découvert par le NIID à Tokyo, au Japon, et est proche du B.1.351. Le variant P.1 fut détecté chez quatre voyageurs revenant de Manaus, au Brésil, fin 2020. En octobre 2020, il était le variant dominant (75%) dans les villes d'Amérique latine. Il est également présent aux États-Unis depuis fin janvier 2021, dans plusieurs pays d'Europe et en Turquie.

Ce variant porte 14 mutations (et une délétion) dont les principales se situent sur les gènes exprimant la protéine S. Les mutations clés de la protéine S sont similaires à celles du variant B.1.351, bien qu'elles soient apparues indépendamment :

- N501Y aide le virus à s'accrocher plus étroitement aux cellules humaines. Cette mutation apparaît également dans les variants B.1.1.7 et B.1.351.

- K417T se situe sur le même site que la mutation K417N du variant B.1.351. Elle peut aider le virus à se verrouiller plus étroitement au récepteur cellulaire.

- E484K peut aider le virus à échapper à certains types d'anticorps monoclonaux et polyclonaux.

Le variant Gamma est présent dans 54 pays mais principalement en Amérique du Nord et au Brésil.

A gauche, aperçu phylogénétique du variant Alpha (B.1.1.7) du Covid-19 apparu en Angleterre en septembre 2020. Ce variant a subi une mutation à la position 501 N→Y et une double délétion aux positions 69/70. A droite, proportion des différents variants actifs au Royaume-Uni mi-décembre 2020. Documents Nextstrain et adaptation de Emma Hodcroft.

Le variant L452R (US)

Le variant L452R fut découvert au Danemark en mars 2020 et fut ensuite identifié aux Etats-Unis. Selon l'autorité de santé publique de Santa Clara (SSC.gov) en Californie, ce variant est devenu de plus en plus courant dans plusieurs comtés californiens et est responsable de plusieurs foyers épidémiques importants dans l'État.

Les résultats du séquençage montrent que la proportion de personnes contaminées par ce variant est passée de 3.8 à 25% entre la mi-novembre et la fin décembre 2020. Selon le "Washington Post", dans l'un des foyers le variant L452R fut transmis à un membre du personnel de l'hôpital de San José portant un costume d'arbre de Noël gonflable qui aurait pu infecter au moins 90 personnes.

Selon Erica Pan, épidémiologiste au Département de la santé publique de Californie, "Il est trop tôt pour savoir si cette variante se répandra plus rapidement que d'autres". En février 2021, cette mutation était présente chez ~45% des échantillons récoltés en Californie.

Le variant B.1.429 (US)

Le variant B.1.429 est apparu en Californie, dans la banlieue de Los Angeles, en juillet 2020 et est responsable de la vague épidémique qui survint dans la mégapole. Depuis, il s'est répandu dans 26 pays, y compris en Europe où on a identifé quelques cas, notamment en Angleterre, en France et en Scandinavie.

Ce variant porte 10 mutations dont certaines sur les acides aminés S13I, W152C, L452R et D614G. Les mutations L452R et D614G réduisent la capacité de neutralisation des anticorps et donc augmentent le pouvoir infectieux du virus.

Le variant B.1.427 (US)

Le variant B.1.427 fut identifié fin septembre 2020 en Californie, il est présent dans toute l'Amérique du Nord et dans 14 pays autour dans le monde, dont l'Angleterre et l'Italie.

Ce variant porte 8 mutations dont certaines sur les acides aminés L452R et D614G. Les mutations L452R et D614G réduisent la capacité de neutralisation des anticorps et donc augmentent le pouvoir infectieux du virus.

Le variant COH.20G/501Y (US)

Le variant COH.20G/501Y fut découvert aux États-Unis en décembre 2020. Selon le College of Medicine, il porte une mutation identique au variant britannique B.1.1.7, mais elle est probablement apparue dans un variant qui était déjà présent aux États-Unis. Les chercheurs signalent également l'évolution d'un autre variant américain qui développa trois autres mutations géniques qui n'avaient jusqu'ici jamais été observées ensemble dans le Covid-19. La découverte de ce variant dit de Columbus fit l'objet d'une article publié sur "bioRxiv" (non validé) par l'équipe de Dan Jones le 15 janvier 2021.

On ignore encore sa prévalance dans la population. En revanche, il est devenu le virus dominant à Columbus, Ohio, pendant une période de trois semaines, entre fin décembre 2020 et janvier 2021.

Selon Jones, "ces trois mutations [dans le variant de Columbus] représentent une évolution significative. Nous savons que ce changement n'est pas venu des branches britanniques ou sud-africaines du virus. [...] Les changements observés au cours des deux derniers mois ont été plus importants que dans les premiers mois de la pandémie."

Les chercheurs suggèrent que la même mutation aurait pu se produire indépendamment dans plusieurs régions du monde au cours des derniers mois (c'est-à-dire depuis novembre 2020).

Le variant B.1.525 (WAN)

Le variant B.1.525 fut détecté au Nigéria le 11 décembre 2020. Il est présent dans 61 pays, y compris en Europe et en Amérique du Nord.

Il contient deux délétions (H69-V70 et Y144) sur la protéine S commune avec le variant Alpha (B.1.1.7) et la mutation E484K commune aux variants Beta (B.1.351) et Gamma (P.1) qui permet au virus d'échapper aux cellules mémoires des défenses immunitaires.

Il comprend également des substitutions d'acides aminés Q52R, Q677H et F888L73. Des substitutions répétées d'acides aminés en position 677 et l'émergence indépendante de Q677H dans plusieurs variants aux États-Unis sont des indices forts de l'adaptation du virus (cf. D.L. Robertson et al., 2021).

Le variant B.1.617 (IN)

Le variant B.1.617 fut découvert en octobre 2020 près de Nagpur, en Inde. En avril 2021, il représentait en moyenne ~11% des contaminations dans le pays mais sa prévalence atteint 55% à Nagpur et Mumbai. Le variant était également présent au Royaume-Uni, en Irlande, en Allemagne, et en Belgique, mais avec une très faible occurrence.

Ce variant présente 15 mutations dont deux connues, L452R identique à celle du variant californien qui le rend plus résistant aux anticorps et E484Q très proche de la mutation observée sur les variants brésilien et sud-africain qui le rende plus contagieux. C'est la première fois qu'on identifie ces deux mutations sur le même variant. Apparement ce variant est moins infectieux que le variant B.1.177 britannique.

Du variant B.1.617 sont nés trois lignées :B.1.617.1 (Kappa) et B.1.617.2 (Delta) qui donna le sous-variant B.1.617.3.

Le variant Delta (B.1.617.2 ou G/452R.V3) fut également détecté en Inde fin 2020. Il présente 17 mutations dont 2 délétions. Il ne présente pas la mutation E484Q mais T478K sur la protéine S (cf. F.M. Giorgi et al., 2021) qui n'est pas présente dans les deux autres variants.

L'OMS a prévenu les autorités nationales que le variant Delta serait environ 40% plus transmissible que le variant Alpha (B.1.1.7) qui est lui-même 35 à 90% plus contagieux que la souche originale.

Le variant Delta peut échapper à certains vaccins mais en pratique des études ont montré que les vaccins à deux doses nous protègent également contre ce variant. On y reviendra.

Ce variant Delta serait responsable de la deuxième vague épidémique survenue en Inde en février 2021. Il est présent en Europe et est devenu le variant dominant au Royaume-Uni mais reste minoritaire en Belgique et en France notamment. Sa propagation rapide reste préoccupante.

Le variant Delta pose un problème de santé publique car s'il est dominant il augmente le Ro, le taux de reproduction de base du virus et par conséquent la couverture vaccinale doit concerner plus de personnes pour atteindre l'immunité collective. Jusque fin 2020, en Europe pour un Ro ~3 on estimait que ~70% de la population devait être vaccinée pour être globalement protégée. Avec ce variant, Ro > 5 et on devrait vacciner 85 à 90% de la population.

Selon l'OMS, "Il est devenu évident que davantage de risques pour le public sont associés au B.1.617.2" (via ONU).

Le variant B.1.1.248 (BR)

Le variant B.1.1.248, également nommé VOC-202012/01, a également été découvert au Brésil. Il fut détecté le 2 janvier 2021 chez quatre personnes de retour au Japon après un séjour dans l'État d'Amazonas (Manaus) situé au nord-ouest du Brésil (Manaus). Il apparut alors que le Brésil subissait une deuxième vague épidémique aussi importante que la première, notamment à Manaus.

Le variant B.1.1.248 a par la suite perdu son statut de variant distinct et fut reclassé en B.1.1.28. Il descend du variant Gamma (P.1 alias B.1.1.28.1).

 Selon les chercheurs du NIID japonais, B.1.1.28 présente 12 mutations dans la protéine S dont N501Y et E484K qui modifient légèrement la forme de la protéine S. La mutation à la position E484K est associée à la fuite d'anticorps neutralisants, c'est-à-dire qu'elle permet au virus d'échapper aux cellules mémoires des défenses immunitaires. Du fait de sa capacité à échapper aus défenses immunitaires, il inquiète plus les chercheurs que d'autres variants, d'autant que l'épidémie au Covid-19 a fortement touché la population brésilienne (la barre des 200000 décès fut franchie le 8 janvier 2021) et que cette mutation E484K est également présente au Royaume-Uni.

Au 15 janvier 2021, ce variant était présent dans 31 pays dont 15 pays d'Amérique du Sud et continuait à se propager.

Ceci dit, il existe beaucoup d'autres variants mais leur proportion est généralement très faible. Ils se concentrent dans certaines villes voire même dans certaines populations, d'où la nécessité de dépister tout le monde et périodiquement.

Situation en Europe

Selon l'ECDC, en Europe, en date du 3 juin 2021, quatre variants étaient très actifs et classés VOC : B.1.1.7 (Alpha) qui domine, B.1.351 (Beta), P.1 (Gamma) et depuis peu de temps B.1.617.2 (Delta). Une trentaine d'autre variants sont également présents mais beaucoup moins actifs (VOI ou sous surveillance).

Situation aux Etats-Unis

Selon le CDC, aux États-Unis, en date du 4 juin 2021, il y avait plus de 200 variants actifs. Les plus fréquents sont Alpha (B.1.1.7) qui domine largement les autres (73% des cas), Gamma (P.1, 9.8% des cas) et Iota (B.1.526, 4.7% des cas), tous en augmentation. Si une poignée d'autres représentent entre 4 et 1% des cas, plus de 200 autres souches circulent très peu avec moins de 1% des cas. Comme ont s'y attend, les variants sont plus fréquents dans les États les plus peuplés (Ct, Ma, Pa, Fl, Ga, Tn, Mi, Co, Ca).

Pour la Chine et la Russie nous avons évidemment très peu de données fiables.

A consulter : SARS-CoV-2 variants of concern, ECDC, May 2021

SARS-CoV-2 Variant Classifications and Definitions, CDC, May 2021

Spike variants (liste des mutations du SARS-CoV-2), U.Stanford

Analyse des variants et de leurs effets

Dans une étude publiée dans la revue "Cell" (en PDF) le 3 septembre 2020, Huang Weijin du NIFDC chinois et ses collègues ont constaté chez près d'une centaine de variants du Covid-19 la forte glycosylation de la protéine S; dans de nombreux sites de son génome, une mutation (N→Q) permet à un glucide de se lier à la protéine pour faciliter la réaction enzymatique. Les chercheurs ont étudié 80 variants et 26 mutations du Covid-19 et analysé leurs effets sur l'infectivité et la réactivité des anticorps neutralisants et les sérums d'anciens patients en convalescence.

Les schémas ci-dessous préparés par Weijin et ses collègues présentent les substitutions des acides aminés dans les variants qu'ils ont étudiés. Au-dessus, en rouge figurent les variants (D614G, D839Y, G1124V, L5F, L8V) et en vert les variants combinés avec D614G sur l'ensemble du gène codant pour la protéine S à l'exclusion du RBD (le domaine de liaison au récepteur). Au centre sont représentés les variants dans RBD. Enfin, en dessous, en bleu figurent toutes les mutations sur les sites supposés de glycosylation (N→Q), soit 22 sites. Ce groupe comprend des mutations (N→Q), une combinaison de deux mutations de site de glycosylation dans RBD et trois variants naturels (N74K, N149H et T719A), avec l'ablation des sites de glycosylation. Les sites où on observe fréquemment des substitution d'acides aminés (fréquence > 0.1%) sont surlignés en rouge.

Selon les chercheurs, "le variant D614G, ainsi que plusieurs variants contenant à la fois D614G et une autre substitution d'acide aminé, étaient significativement plus infectieux. La plupart des variants présentant une mutation au niveau du domaine de liaison au récepteur étaient moins infectieux, mais des variants comprenant A475V, L452R, V483A et F490L sont devenus résistants à certains anticorps neutralisants. De plus, la majorité des délétions de glycosylation étaient moins infectieuses, tandis que la suppression de la glycosylation N331 et N343 réduisait considérablement l'infectivité, révélant l'importance de la glycosylation pour l'infectivité virale. Fait intéressant, le variant N234Q était très résistant aux anticorps neutralisants, tandis que le N165Q devenait plus sensible. Ces résultats pourraient être utiles pour le développement de vaccin et anticorps thérapeutiques."

Concernant le variant Alpha (B.1.1.7), selon un rapport du comité SAGE publié le 21 janvier 2021, il serait associé à un risque plus élevé de décès que les autres variants.

À ce jour (juin 2021) au moins 5 variants du SARS-CoV-2 dont Alpha (B.1.1.7), Beta (B.1.351), Gamma (P.1), Delta (B.1.617.2) et B.1.1.28 sont à la fois plus contagieux et sont capables d'échapper aux défenses du système immunitaire. Ils sont égalements actifs plus longtemps. Mais rien ne prouve qu'il existerait un variant plus virulent que l'autre. En revanche, ils sont plus virulents que le SARS-CoV-2 original.

Les virus recombinants du SARS-CoV-2

Elaboration d'un virus recombinant à partir de fragments d'ARN de deux variants existants. Document T.Lombry.

Dans un article publié sur le forum "Virological" le 18 décembre 2020, des chercheurs britanniques comprenant des membres du consortium COG-UK ont analysé des séquences génomiques du Covid-19 prélevées au Royaume-Uni et ont détecté un certain nombre de variants qui avaient été attribués à la lignée B.1.1.7 mais qui ne contiennent pas l'ensemble complet des mutations définissant la lignée du B.1.1.7. L'examen de ces séquences révéla que certaines sections du génome portent des mutations caractéristiques du B.1.1.7, tandis que d'autres sections portent des mutations spécifiques du variant B.1.429 originaire de Californie. Selon les chercheurs, "de longues séries de mutations le long du génome du SARS-CoV-2 qui correspondent à différentes lignées sont fortement indicatives de la recombinaison du virus".

Lors d'une réunion (webinar) organisée par l'Académie des Sciences de New York le 2 février 2021, on apprit que le premier spécimen de virus recombinant du SARS-CoV-2 avait été découvert par la biologiste théoricienne et biophysicienne Bette Korber du Laboratoire National de Los Alamos (LANL) au Nouveau-Mexique qui déclara qu'elle en avait vu des preuves "assez claires" dans sa base de données de génomes viraux américains. Korber n'a vu qu'un seul génome recombinant parmi des milliers de séquences et à l'époque il n'était pas encore établi si le virus se transmettait d'une personne à l'autre ou s'il s'agissait de la mutation d'un virus ponctuel.

Notons que sous la signature du rédacteur Graham Lawton, la revue "The New Scientist" du 16 février 2021 publia le premier article de vulgarisation sur cette découverte.

Puis, le 17 mars 2021 les mêmes chercheurs britanniques annoncèrent dans un nouvel article publié sur le forum "Virological" avoir identifié 8 virus recombinants du SARS-CoV-2. Ces versions hybrides combinent une partie du génome du variant B.1.1.7 et l'un des variants B.1.177, B.1.36.27, B.1.36.28 ou B.1.221, tous originaires majoritairement du Royaume-Uni (le même variant pouvant avoir été identifié dans plusieurs pays à la même époque). Ils sont répartis en quatre groupes auxquels s'ajoute 4 autres recombinants putatifs dont la liste est présentée ci-dessous.

Ces virus recombinants se sont probablement développés au Royaume-Uni pendant une période de forte positivité au Covid-19, qui représentait ~1 à 2% de la population générale en Angleterre entre octobre 2020 et janvier 2021 (cf. UK - Office for National Statistics, 12 mars 2021). Pendant ce temps, le variant B.1.1.7 s'est rapidement répandu à travers le Royaume-Uni, remplaçant les variants britanniques précédemment existants qui présentaient déjà des incidences élevées, dont les plus courants étaient le B.1.177 et ses descendants (cf. E.Volz et al., 4 janvier 2021).

Bien que moins fréquente que les variants, la recombinaison est une caractéristique fréquente et bien documentée de l'évolution moléculaire des coronavirus (cf. R.L. Graham et al., 2010) qu'on retrouve chez plusieurs espèces de Betacoronavirus du sous-genre Sarbecovirus (cf. M.F. Boni et al., et en PDF, 2020;  B.Hu et al., 2017; C-C.Hon et al., 2008) dont le SARS-CoV-2 (cf. D.VanInsberghe et al., 2020).

La recombinaison se produit probablement chez chaque individu contaminé, mais dans presque tous les cas, elle se produit entre des génomes presque identiques (descendants du petit pool de virus à l'origine de la contamination).

Génomes putatifs du SARS-CoV-2 recombinants et leurs structures génomiques inférées. Les groupes recombinants A-D contiennent plusieurs séquences présentant les mêmes structures génomiques recombinées, dites en mosaïque. Les quatre rangées inférieures sont des évènements recombinants ayantun seul représentant ou singletons. Les zones correspondant à la lignée B.1.1.7 sont représentées en bleu, tandis que les régions du génome du virus correspondant à d'autres lignées sont affichées en jaune. Les écarts représentent l'ambiguïté de la position exacte des points de rupture recombinants; ces régions du génome pourraient avoir été héritées de l'une ou l'autre des lignées parentales (c'est-à-dire qu'il n'y a pas de mutations définissant la lignée dans ces régions). Document Consortium COG-UK et al. (2021) adapté par l'auteur.

Pour rappel, ces recombinaisons sont le résultat d'une erreur lors de la copie de l'ARN viral par la polymérase. L'enzyme bloque sur un brin d'ARN et utilise à la place un autre brin qui s'ajoute à la nouvelle séquence. Selon les chercheurs, "ces remplacements d'acides aminés individuels dans le génome du SARS-CoV-2 sont principalement le résultat d'une réplication sujette aux erreurs et ne devraient pas avoir d'effets phénotypiques, la plupart des évènements de recombinaison sont simplement le résultat des processus intra-hôte qui se produisent à chaque contamination".

Rappelons aussi que dans les vaccins recombinants, les chercheurs tirent parti de cette technique pour introduire dans les cellules humaines des vecteurs recombinés génétiquement qui permettront aux gènes de fabriquer des versions inoffensives de molécules étrangères dont la protéine S (cf. les vaccins Spoutnik V de Gamaleya, NVX-CoV2373 de Novavax, AZD1222 d'AstraZeneca/Oxford) afin que les défenses immunitaires apprennent à la reconnaître et la détruisent.

S'il est possible de fabriquer un virus recombinant en laboratoire (cf. T.Fukuhara et al., 2020), jusqu'à preuve du contraire aucun n'est sorti des labos et n'a contaminé un être humain. Cette éventualité est donc exclue. 

En revanche, on ne peut pas (encore) exclure une contamination survenue en laboratoire bien que la probabilité soit très faible. En effet, l'une des raisons possibles pour lesquelles une séquence génomique pourrait avoir une structure recombinée dite en mosaïque est qu'il s'agit du résultat d'un séquençage de lectures à partir de différents variants présents soit en raison d'une contamination en laboratoire, soit parce qu'un mélange de variants était présent dans l'échantillon ou dans le patient.

Selon les chercheurs, bien que cela puisse donner naissance à des virus recombinants, le protocole de séquençage utilisé au Royaume-Uni (cf. J.R. Tyson et al., 2020) génère 98 amplicons courts de ~350 pb, de sorte que de longs domaines qui correspondent à un seul variant ou une seule lignée seraient peu probables. Pour les groupes A-D ci-dessus, cette possibilité peut également être exclue car plusieurs génomes ayant la même structure recombinée sont séquencés indépendamment de différents échantillons, ce qui implique qu'une transmission du recombinant s'est produite. Il convient également de noter que pour le groupe A, l'un des trois génomes recombinants putatifs fut séquencé dans une installation différente des deux autres.

Pour les quatre autres virus recombinants putatifs ayant un seul représentant, selon les chercheurs il est possible que le cas échantillonné soit une coinfection et donc l'échantillon soit un mélange non naturel, mais vu le protocole de séquençage utilisé, c'est peu probable. Étant donné que les chercheurs ont observé quatre versions ou instances de génomes recombinants, ils concluent n'avoir aucune raison de soupçonner que les quatre singletons ne sont pas également des recombinants.

Étant donné que depuis février ou mars 2021 de nombreux autres pays connaissent des niveaux d'incidence comparables à ceux du Royaume-Uni entre la fin de 2020 et le début de 2021, les chercheurs prévoient "que la recombinaison entre des lignées distinctes sera couramment détectée partout où un séquençage intensif du génome est entrepris. La recombinaison entre des variantes génétiquement similaires sera également courante mais plus difficile à détecter".

Ces variants hybrides ne signifient pas nécessairement que le virus est plus contagieux ou plus virulent. Contrairement à une mutation, comme celle du variant Alpha (B.1.1.7) où les changements s'accumulent un par un, la recombinaison peut rassembler plusieurs mutations en une seule fois. La plupart du temps, si celles-ci ne confèrent aucun avantage au virus, parfois elles lui permettent de mieux s'adapter à son environnement.

Selon François Balloux de l'University College London, la recombinaison peut avoir une importance évolutive majeure et est un phénomène considéré par beaucoup de spécialistes comme à l'origine du SARS-CoV-2. En effet, les zoonoses nous prouvent tous les jours que de nombreuses chauves-souris portent des virus recombinants de coronavirus.

En théorie, la recombinaison pourrait conduire à l'émergence de nouveaux variants plus dangereux, mais actuellement on ne sait pas encore à quel point ces évènements de recombinaisons pourraient représenter une menace.

Des prédispositions héritées des Néandertaliens

La paléogénétique nous apprend que nous avons hérité d'une partie du patrimoine génétique des premiers humains (Homo sapiens et Homo denisova parmi d'autres) et de toute évidence d'autres sous-espèces par métissage. En effet, certaines populations ont hérité de nos Ancêtres de gènes spécifiques leur permettant par exemple de mieux supporter les climats extrêmes ou renforçant leur système immunitaire face à certaines maladies. Mais parfois, cet héritage cause plus de mal que de bien.

Des études ont montré que certaines mutations génétiques étaient fréquemment présentes chez les patients Covid souffrant de formes sévères de la maladie. A ce jour, on a identifié 22 variants génétiques ou allèles touchant 8 gènes différents ayant un effet délétère sur la réponse du système immunitaire contre le Covid-19. Près de 15% des formes sévères de Covid s'expliquent par ces prédispositions génétiques héritées des Néandertaliens.

Nous reviendrons en détails sur le sujet dans l'article consacré au métissage entre les premiers humains et leurs conséquences actuelles.

Dernier chapitre

Efficacité des vaccins sur les variants

Page 1 - 2 - 3 - 4 -


Back to:

HOME

Copyright & FAQ